Recombinant Human LY6G6D Protein

Recombinant Human LY6G6D Protein
SKU
ASBPP-3351-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95868

Gene Name: LY6G6D

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Asn20

End Site: Ser104

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 58%, Pig - 66%, Cynomolgus monkey - 100%

Alternative gene names: C6orf23; G6D; MEGT1; NG25

Alternative protein names: Lymphocyte antigen 6 complex locus protein G6d; Protein Ly6-D; Megakaryocyte-enhanced gene transcript 1 protein

Protein name: lymphocyte antigen 6 family member G6D

Full length: 133 amino acids

Entry name: LY66D_HUMAN
More Information
SKU ASBPP-3351-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3351-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 58530
Product information (PDF)
×
MSDS (PDF)
×