Recombinant Human LY6K Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q17RY6

Gene Name: LY6K

Expression System: Escherichia coli

Molecular Weight: 27 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Asp18

End Site: Gly138

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%, Pig - 42%, Cynomolgus monkey - 84%

Alternative gene names: CO16

Alternative protein names: Lymphocyte antigen 6K; Ly-6K

Protein name: lymphocyte antigen 6 family member K

Full length: 165 amino acids

Entry name: LY6K_HUMAN

• SKU: ASBPP-3244-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3244-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54742