Recombinant Human LYPD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N2G4

Gene Name: LYPD1

Expression System: Escherichia coli

Molecular Weight: 53 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu21

End Site: Ser117

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: Lynx2; LYPDC1

Alternative protein names: Ly6/PLAUR domain-containing protein 1; Putative HeLa tumor suppressor; PHTS

Protein name: LY6/PLAUR domain containing 1

Full length: 141 amino acids

Entry name: LYPD1_HUMAN

• SKU: ASBPP-3152-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3152-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 116372