Recombinant Human LYPD1 Protein

Recombinant Human LYPD1 Protein
SKU
ASBPP-3153-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N2G4

Gene Name: LYPD1

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu21

End Site: Ser117

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: Lynx2; LYPDC1

Alternative protein names: Ly6/PLAUR domain-containing protein 1; Putative HeLa tumor suppressor; PHTS

Protein name: LY6/PLAUR domain containing 1

Full length: 141 amino acids

Entry name: LYPD1_HUMAN
More Information
SKU ASBPP-3153-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3153-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 116372
Product information (PDF)
×
MSDS (PDF)
×