Recombinant Human MAGOHB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96A72

Gene Name: MAGOHB

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Asn41

End Site: Gly120

Coverage: 0.57

Isoelectric Point: 5.5

Core Sequence: NYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MAGOH2

Alternative protein names: Protein mago nashi homolog 2

Protein name: mago homolog B, exon junction complex subunit

Full length: 148 amino acids

Entry name: MGN2_HUMAN

• SKU: ASBPP-3272-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3272-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55110