Recombinant Human MAP1LC3B2 Protein

Recombinant Human MAP1LC3B2 Protein
SKU
ASBPP-4004-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A6NCE7

Gene Name: MAP1LC3B2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Gly120

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Microtubule-associated proteins 1A/1B light chain 3 beta 2; Microtubule-associated proteins 1A/1B light chain 3B-like

Protein name: microtubule associated protein 1 light chain 3 beta 2

Full length: 125 amino acids

Entry name: MP3B2_HUMAN
More Information
SKU ASBPP-4004-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4004-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 643246
Product information (PDF)
×
MSDS (PDF)
×