Recombinant Human MAPK9 Protein

Recombinant Human MAPK9 Protein
SKU
ASBPP-296-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P45984

Gene Name: MAPK9

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Glu331

End Site: Leu420

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: EAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: JNK2; PRKM9; SAPK1A

Alternative protein names: Mitogen-activated protein kinase 9; MAP kinase 9; MAPK 9; JNK-55; Stress-activated protein kinase 1a; SAPK1a; Stress-activated protein kinase JNK2; c-Jun N-terminal kinase 2

Protein name: mitogen-activated protein kinase 9

Full length: 424 amino acids

Entry name: MK09_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-296-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-296-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5601
Product information (PDF)
×
MSDS (PDF)
×