Recombinant Human MARCHF11 Protein

Recombinant Human MARCHF11 Protein
SKU
ASBPP-3075-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A6NNE9

Gene Name: MARCHF11

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Glu21

End Site: Gly190

Coverage: 0.44

Isoelectric Point: 5.5

Core Sequence: EPPPQPPPPPPPTPPPGEPAPVPAAPRYLPPLPASPETPERAAGPSEPLGEVAPRCRGADELPPPPLPLQPAGQEVAAAGDSGEGPRRLPEAAAAKGGPGESEAGAGGERERRGAGDQPETRSVCSSRSSSSGGGDQRAGHQHQHHQPICKICFQGAEQGELLNPCRCDG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 68%, Pig - 81%, Cynomolgus monkey - 100%

Alternative gene names: MARCH11

Alternative protein names: E3 ubiquitin-protein ligase MARCHF11; Membrane-associated RING finger protein 11; Membrane-associated RING-CH protein XI; MARCH-XI; RING-type E3 ubiquitin transferase MARCHF11

Protein name: membrane associated ring-CH-type finger 11

Full length: 402 amino acids

Entry name: MARHB_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-3075-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3075-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 441061
Product information (PDF)
×
MSDS (PDF)
×