Recombinant Human MAZ Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P56270

Gene Name: MAZ

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val311

End Site: Ala440

Coverage: 0.27

Isoelectric Point: 9

Core Sequence: VCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 40%, Pig - 100%, Cynomolgus monkey - 65%

Alternative gene names: ZNF801

Alternative protein names: Myc-associated zinc finger protein; MAZI; Pur-1; Purine-binding transcription factor; Serum amyloid A-activating factor-1; SAF-1; Transcription factor Zif87; ZF87; Zinc finger protein 801

Protein name: MYC associated zinc finger protein

Full length: 477 amino acids

Entry name: MAZ_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-319-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-319-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4150