Recombinant Human MAZ Protein

Recombinant Human MAZ Protein
SKU
ASBPP-319-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P56270

Gene Name: MAZ

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val311

End Site: Ala440

Coverage: 0.27

Isoelectric Point: 9

Core Sequence: VCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 40%, Pig - 100%, Cynomolgus monkey - 65%

Alternative gene names: ZNF801

Alternative protein names: Myc-associated zinc finger protein; MAZI; Pur-1; Purine-binding transcription factor; Serum amyloid A-activating factor-1; SAF-1; Transcription factor Zif87; ZF87; Zinc finger protein 801

Protein name: MYC associated zinc finger protein

Full length: 477 amino acids

Entry name: MAZ_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-319-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-319-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4150
Product information (PDF)
×
MSDS (PDF)
×