Recombinant Human MBD3L1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WWY6

Gene Name: MBD3L1

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Arg41

End Site: Arg190

Coverage: 0.82

Isoelectric Point: 6.5

Core Sequence: RITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Pig - 62%

Alternative gene names: MBD3L

Alternative protein names: Methyl-CpG-binding domain protein 3-like 1; MBD3-like protein 1

Protein name: methyl-CpG binding domain protein 3 like 1

Full length: 194 amino acids

Entry name: MB3L1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3749-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3749-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 85509