Recombinant Human MBTD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q05BQ5

Gene Name: MBTD1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Phe371

End Site: Pro560

Coverage: 0.31

Isoelectric Point: 5.5

Core Sequence: FAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 73%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: MBT domain-containing protein 1

Protein name: mbt domain containing 1

Full length: 628 amino acids

Entry name: MBTD1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3326-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3326-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 54799