Note: Dry Ice fees will be extra-charged
Uniprot: Q9UJA3
Gene Name: MCM8
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 90%
Start Site: Pro91
End Site: Asn190
Coverage: 0.12
Isoelectric Point: 4.5
Core Sequence: PLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVN
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 86%, Cynomolgus monkey - 93%
Alternative gene names: C20orf154
Alternative protein names: DNA helicase MCM8; Minichromosome maintenance 8
Protein name: minichromosome maintenance 8 homologous recombination repair factor
Full length: 840 amino acids
Entry name: MCM8_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
