Recombinant Human MCM8 Protein

Recombinant Human MCM8 Protein
SKU
ASBPP-3237-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UJA3

Gene Name: MCM8

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Pro91

End Site: Asn190

Coverage: 0.12

Isoelectric Point: 4.5

Core Sequence: PLIEKIQAFEKFFTRHIDLYDKDEIERKGSILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 86%, Cynomolgus monkey - 93%

Alternative gene names: C20orf154

Alternative protein names: DNA helicase MCM8; Minichromosome maintenance 8

Protein name: minichromosome maintenance 8 homologous recombination repair factor

Full length: 840 amino acids

Entry name: MCM8_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-3237-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3237-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84515
Product information (PDF)
×
MSDS (PDF)
×