Recombinant Human MDGA2 Protein

Recombinant Human MDGA2 Protein
SKU
ASBPP-3074-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z553

Gene Name: MDGA2

Expression System: Escherichia coli

Molecular Weight: 47.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ile31

End Site: Ala330

Coverage: 0.34

Isoelectric Point: 8

Core Sequence: IVHSGLACNIEEERYSERVYTIREGETLELTCLVTGHPRPQIRWTKTAGSASDRFQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDDPVVTVHQSIGEAKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGVEIYEPFFTQGETKILKLKNLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTASPSIKLLVDDPIVVNPGEAITLVCVTTGGEPAPSLTWVRSFGTLPEKTVLNGGTLTIPAITSDDAGTYSCIANNNVGNPAKKSTNIIVRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: MAMDC1

Alternative protein names: MAM domain-containing glycosylphosphatidylinositol anchor protein 2; MAM domain-containing protein 1

Protein name: MAM domain containing glycosylphosphatidylinositol anchor 2

Full length: 956 amino acids

Entry name: MDGA2_HUMAN
More Information
SKU ASBPP-3074-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3074-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 161357
Product information (PDF)
×
MSDS (PDF)
×