Recombinant Human MED10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BTT4

Gene Name: MED10

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met1

End Site: Ser135

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Mediator of RNA polymerase II transcription subunit 10; Mediator complex subunit 10; Transformation-related gene 17 protein; TRG-17; Transformation-related gene 20 protein; TRG-20

Protein name: mediator complex subunit 10

Full length: 135 amino acids

Entry name: MED10_HUMAN

• SKU: ASBPP-3022-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3022-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84246