Recombinant Human MED12L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86YW9

Gene Name: MED12L

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ile1701

End Site: Gly1770

Coverage: 0.03

Isoelectric Point: 7.5

Core Sequence: IKYEEQHHLLLYHTHPMPKPRSYYLQPLPLPPEEEEEEPTSPVSQEPERKSAELSDQGKTTTDEEKKTKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 91%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1635; TNRC11L; TRALP; TRALPUSH

Alternative protein names: Mediator of RNA polymerase II transcription subunit 12-like protein; Mediator complex subunit 12-like protein; Thyroid hormone receptor-associated-like protein; Trinucleotide repeat-containing gene 11 protein-like

Protein name: mediator complex subunit 12L

Full length: 2145 amino acids

Entry name: MD12L_HUMAN

• SKU: ASBPP-3243-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3243-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 116931