Recombinant Human MED20 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H944

Gene Name: MED20

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Val11

End Site: Phe160

Coverage: 0.78

Isoelectric Point: 6.5

Core Sequence: VAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%

Alternative gene names: TRFP

Alternative protein names: Mediator of RNA polymerase II transcription subunit 20; Mediator complex subunit 20; TRF-proximal protein homolog; hTRFP

Protein name: mediator complex subunit 20

Full length: 212 amino acids

Entry name: MED20_HUMAN

• SKU: ASBPP-3310-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3310-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9477