Recombinant Human MED7 Protein

Recombinant Human MED7 Protein
SKU
ASBPP-3023-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43513

Gene Name: MED7

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Pro233

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: ARC34; CRSP9

Alternative protein names: Mediator of RNA polymerase II transcription subunit 7; hMED7; Activator-recruited cofactor 34 kDa component; ARC34; Cofactor required for Sp1 transcriptional activation subunit 9; CRSP complex subunit 9; Mediator complex subunit 7; RNA polymerase transcriptional regulation mediator subunit 7 homolog; Transcriptional coactivator CRSP33

Protein name: mediator complex subunit 7

Full length: 233 amino acids

Entry name: MED7_HUMAN
More Information
SKU ASBPP-3023-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3023-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9443
Product information (PDF)
×
MSDS (PDF)
×