Recombinant Human MEF2A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q02078

Gene Name: MEF2A

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Glu71

End Site: Ala170

Coverage: 0.21

Isoelectric Point: 5

Core Sequence: EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 98%, Pig - 99%

Alternative gene names: MEF2

Alternative protein names: Myocyte-specific enhancer factor 2A; Serum response factor-like protein 1

Protein name: myocyte enhancer factor 2A

Full length: 507 amino acids

Entry name: MEF2A_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3732-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3732-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4205