Recombinant Human METTL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBP6

Gene Name: METTL1

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Pro41

End Site: Lys250

Coverage: 0.77

Isoelectric Point: 7

Core Sequence: PEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%

Alternative gene names: C12orf1

Alternative protein names: tRNA; guanine-N(7)-)-methyltransferase; Methyltransferase-like protein 1; mRNA; guanine-N(7)-)-methyltransferase; miRNA; guanine-N(7)-)-methyltransferase; tRNA; guanine(46)-N(7))-methyltransferase; tRNA(m7G46)-methyltransferase

Protein name: methyltransferase 1, tRNA methylguanosine

Full length: 276 amino acids

Entry name: TRMB_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3323-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3323-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 4234