Recombinant Human METTL5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRN9

Gene Name: METTL5

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Glu51

End Site: Ile200

Coverage: 0.75

Isoelectric Point: 6

Core Sequence: ENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMAFLKTALEMARTAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHKKKSVDI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: rRNA N6-adenosine-methyltransferase METTL5; Methyltransferase-like protein 5

Protein name: methyltransferase 5, N6-adenosine

Full length: 209 amino acids

Entry name: METL5_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3254-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3254-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 29081