Recombinant Human MFRP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BY79

Gene Name: MFRP

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Gln131

End Site: Asp290

Coverage: 0.29

Isoelectric Point: 5

Core Sequence: QQESGVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNASHLLVVFVSDSSVEGFGFHAWYQAMAPGRGSCAHDEFRCDQLICLLPDSVCDGFANCADGSD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 38%, Pig - 90%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Membrane frizzled-related protein; Membrane-type frizzled-related protein

Protein name: membrane frizzled-related protein

Full length: 579 amino acids

Entry name: MFRP_HUMAN

• SKU: ASBPP-3229-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3229-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 83552