Recombinant Human MIA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q16674

Gene Name: MIA

Expression System: Escherichia coli

Molecular Weight: 54.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Gly25

End Site: Gln131

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 93%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Melanoma-derived growth regulatory protein; Melanoma inhibitory activity protein

Protein name: MIA SH3 domain containing

Full length: 131 amino acids

Entry name: MIA_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3037-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3037-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8190