Recombinant Human MIB1 Protein

Recombinant Human MIB1 Protein
SKU
ASBPP-10505-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86YT6

Gene Name: MIB1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys421

End Site: Val490

Coverage: 0.08

Isoelectric Point: 6

Core Sequence: KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 40%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: DIP1; KIAA1323; ZZANK2

Alternative protein names: E3 ubiquitin-protein ligase MIB1; DAPK-interacting protein 1; DIP-1; Mind bomb homolog 1; RING-type E3 ubiquitin transferase MIB1; Zinc finger ZZ type with ankyrin repeat domain protein 2

Protein name: MIB E3 ubiquitin protein ligase 1

Full length: 1006 amino acids

Entry name: MIB1_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-10505-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10505-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57534
Product information (PDF)
×
MSDS (PDF)
×