Note: Dry Ice fees will be extra-charged
Uniprot: P14174
Gene Name: MIF
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 89%
Start Site: Pro2
End Site: Ala115
Coverage: 1.00
Isoelectric Point: 7.5
Core Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 100%
Alternative gene names: GLIF; MMIF
Alternative protein names: Macrophage migration inhibitory factor; MIF; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; Phenylpyruvate tautomerase
Protein name: macrophage migration inhibitory factor
Full length: 115 amino acids
Entry name: MIF_HUMAN
Product panel: Cytokines,Enzyme
English
Deutsch
