Recombinant Human MIF Protein

Recombinant Human MIF Protein
SKU
ASBPP-3268-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P14174

Gene Name: MIF

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Pro2

End Site: Ala115

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 90%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: GLIF; MMIF

Alternative protein names: Macrophage migration inhibitory factor; MIF; Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; Phenylpyruvate tautomerase

Protein name: macrophage migration inhibitory factor

Full length: 115 amino acids

Entry name: MIF_HUMAN

Product panel: Cytokines,Enzyme
More Information
SKU ASBPP-3268-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3268-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4282
Product information (PDF)
×
MSDS (PDF)
×