Recombinant Human MIGA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7L4E1

Gene Name: MIGA2

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Asp211

End Site: Ile310

Coverage: 0.18

Isoelectric Point: 4

Core Sequence: DGLRNPETASEPLSEPESQRKEFAEKLESLLHRAYHLQEEFGSTFPADSMLLDLERTLMLPLTEGSLRLRADDEDSLTSEDSFFSATELFESLQTGDYPI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: C9orf54; FAM73B

Alternative protein names: Mitoguardin 2; Protein FAM73B

Protein name: mitoguardin 2

Full length: 593 amino acids

Entry name: MIGA2_HUMAN

• SKU: ASBPP-3123-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3123-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84895