Recombinant Human MINAR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPX6

Gene Name: MINAR1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ser511

End Site: Thr650

Coverage: 0.16

Isoelectric Point: 5

Core Sequence: SEIVSDDISDIFRFLDDMSISGSTGVIQSSCYNSTGSLSQLHKSDCDSSPEHNLTKIANGVPNSKGDKGNRPENTHHSEEELKTSVCKLVLRIGEIERKLESLSGVRDEISQVLGKLNKLDQKMQQPEKVSVQIDLNSLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1024; UBTOR

Alternative protein names: Major intrinsically disordered Notch2-binding receptor 1; Membrane integral NOTCH2-associated receptor 1; Ubiquitination and mTOR signaling protein

Protein name: membrane integral NOTCH2 associated receptor 1

Full length: 916 amino acids

Entry name: MNAR1_HUMAN

• SKU: ASBPP-2947-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2947-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23251