Recombinant Human MINDY3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H8M7

Gene Name: MINDY3

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Lys71

End Site: Ala140

Coverage: 0.18

Isoelectric Point: 5

Core Sequence: KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: C10orf97; CARP; DERP5; FAM188A

Alternative protein names: Ubiquitin carboxyl-terminal hydrolase MINDY-3; Dermal papilla-derived protein 5; Deubiquitinating enzyme MINDY-3; Protein CARP

Protein name: MINDY lysine 48 deubiquitinase 3

Full length: 445 amino acids

Entry name: MINY3_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3114-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3114-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 80013