Recombinant Human MLKL Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NB16

Gene Name: MLKL

Expression System: Escherichia coli

Molecular Weight: 64.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Met21

End Site: Ser470

Coverage: 0.95

Isoelectric Point: 8.5

Core Sequence: MKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 27%, Pig - 64%

Alternative gene names: /

Alternative protein names: Mixed lineage kinase domain-like protein; hMLKL

Protein name: mixed lineage kinase domain like pseudokinase

Full length: 471 amino acids

Entry name: MLKL_HUMAN

• SKU: ASBPP-3287-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3287-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 197259