Recombinant Human MLXIPL Protein

Recombinant Human MLXIPL Protein
SKU
ASBPP-3751-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NP71

Gene Name: MLXIPL

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Arg121

End Site: Ser300

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: RLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDIS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 90%, Pig - 91%

Alternative gene names: BHLHD14; MIO; WBSCR14

Alternative protein names: Carbohydrate-responsive element-binding protein; ChREBP; Class D basic helix-loop-helix protein 14; bHLHd14; MLX interactor; MLX-interacting protein-like; WS basic-helix-loop-helix leucine zipper protein; WS-bHLH; Williams-Beuren syndrome chromosomal region 14 protein

Protein name: MLX interacting protein like

Full length: 852 amino acids

Entry name: MLXPL_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3751-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3751-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 51085
Product information (PDF)
×
MSDS (PDF)
×