Recombinant Human MOAP1 Protein

Recombinant Human MOAP1 Protein
SKU
ASBPP-4029-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96BY2

Gene Name: MOAP1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Asp231

End Site: Ala340

Coverage: 0.34

Isoelectric Point: 4.5

Core Sequence: DECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 59%, Pig - 61%, Cynomolgus monkey - 98%

Alternative gene names: PNMA4

Alternative protein names: Modulator of apoptosis 1; MAP-1; MAP1; Paraneoplastic antigen Ma4

Protein name: modulator of apoptosis 1

Full length: 351 amino acids

Entry name: MOAP1_HUMAN
More Information
SKU ASBPP-4029-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4029-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 64112
Product information (PDF)
×
MSDS (PDF)
×