Recombinant Human MORF4L2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15014

Gene Name: MORF4L2

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Lys41

End Site: Glu110

Coverage: 0.29

Isoelectric Point: 11.5

Core Sequence: KKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 93%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0026; MRGX

Alternative protein names: Mortality factor 4-like protein 2; MORF-related gene X protein; Protein MSL3-2; Transcription factor-like protein MRGX

Protein name: mortality factor 4 like 2

Full length: 288 amino acids

Entry name: MO4L2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-1177-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1177-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9643