Recombinant Human MPP1 Protein

Recombinant Human MPP1 Protein
SKU
ASBPP-362-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q00013

Gene Name: MPP1

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Gly11

End Site: Phe280

Coverage: 0.60

Isoelectric Point: 8

Core Sequence: GGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 53%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: DXS552E; EMP55

Alternative protein names: 55 kDa erythrocyte membrane protein; p55; Membrane protein; palmitoylated 1

Protein name: MAGUK p55 scaffold protein 1

Full length: 466 amino acids

Entry name: EM55_HUMAN
More Information
SKU ASBPP-362-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-362-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4354
Product information (PDF)
×
MSDS (PDF)
×