Recombinant Human MRC2 Protein

Recombinant Human MRC2 Protein
SKU
ASBPP-3312-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBG0

Gene Name: MRC2

Expression System: Escherichia coli

Molecular Weight: 43 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Asp801

End Site: Gln1050

Coverage: 0.17

Isoelectric Point: 6

Core Sequence: DTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSDWIQFLNKCFQVQGQEPQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 84%

Alternative gene names: CLEC13E; ENDO180; KIAA0709; UPARAP

Alternative protein names: C-type mannose receptor 2; C-type lectin domain family 13 member E; Endocytic receptor 180; Macrophage mannose receptor 2; Urokinase-type plasminogen activator receptor-associated protein; UPAR-associated protein; Urokinase receptor-associated protein; CD antigen CD280

Protein name: mannose receptor C-type 2

Full length: 1479 amino acids

Entry name: MRC2_HUMAN

CD Antigen: CD280

Product panel: CD Antigen
More Information
SKU ASBPP-3312-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3312-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9902
Product information (PDF)
×
MSDS (PDF)
×