Recombinant Human MRGBP Protein

Recombinant Human MRGBP Protein
SKU
ASBPP-10421-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV56

Gene Name: MRGBP

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Arg61

End Site: Ser180

Coverage: 0.66

Isoelectric Point: 6.5

Core Sequence: RDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: C20orf20

Alternative protein names: MRG/MORF4L-binding protein; MRG-binding protein; Up-regulated in colon cancer 4; Urcc4

Protein name: MRG domain binding protein

Full length: 204 amino acids

Entry name: MRGBP_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10421-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10421-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55257
Product information (PDF)
×
MSDS (PDF)
×