Recombinant Human MRNIP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6NTE8

Gene Name: MRNIP

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Leu61

End Site: Gln130

Coverage: 0.24

Isoelectric Point: 6.5

Core Sequence: LLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKYLEKDSQELELEGTGVCFSKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 69%, Cynomolgus monkey - 91%

Alternative gene names: C5orf45

Alternative protein names: MRN complex-interacting protein; MRN-interacting protein

Protein name: MRN complex interacting protein

Full length: 343 amino acids

Entry name: MRNIP_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3449-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3449-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51149