Recombinant Human MTA2 Protein

Recombinant Human MTA2 Protein
SKU
ASBPP-3115-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O94776

Gene Name: MTA2

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Cys151

End Site: Gly360

Coverage: 0.33

Isoelectric Point: 6.5

Core Sequence: CKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 75%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: MTA1L1; PID

Alternative protein names: Metastasis-associated protein MTA2; Metastasis-associated 1-like 1; MTA1-L1 protein; p53 target protein in deacetylase complex

Protein name: metastasis associated 1 family member 2

Full length: 668 amino acids

Entry name: MTA2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3115-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3115-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9219
Product information (PDF)
×
MSDS (PDF)
×