Recombinant Human MYBPC2 Protein

Recombinant Human MYBPC2 Protein
SKU
ASBPP-4246-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14324

Gene Name: MYBPC2

Expression System: Escherichia coli

Molecular Weight: 39.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Ala11

End Site: Phe340

Coverage: 0.30

Isoelectric Point: 9.5

Core Sequence: APKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 45%, Pig - 90%, Cynomolgus monkey - 91%

Alternative gene names: MYBPCF

Alternative protein names: Myosin-binding protein C; fast-type; Fast MyBP-C; C-protein; skeletal muscle fast isoform

Protein name: myosin binding protein C2

Full length: 1141 amino acids

Entry name: MYPC2_HUMAN
More Information
SKU ASBPP-4246-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4246-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4606
Product information (PDF)
×
MSDS (PDF)
×