Recombinant Human MYCT1 Protein

Recombinant Human MYCT1 Protein
SKU
ASBPP-328-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N699

Gene Name: MYCT1

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ala101

End Site: Lys230

Coverage: 0.60

Isoelectric Point: 9.5

Core Sequence: APISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: MTLC; MTMC1

Alternative protein names: Myc target protein 1; Myc target in myeloid cells protein 1

Protein name: MYC target 1

Full length: 235 amino acids

Entry name: MYCT1_HUMAN
More Information
SKU ASBPP-328-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-328-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 80177
Product information (PDF)
×
MSDS (PDF)
×