Recombinant Human MYCT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N699

Gene Name: MYCT1

Expression System: Escherichia coli

Molecular Weight: 58.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ala101

End Site: Lys230

Coverage: 0.60

Isoelectric Point: 8

Core Sequence: APISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: MTLC; MTMC1

Alternative protein names: Myc target protein 1; Myc target in myeloid cells protein 1

Protein name: MYC target 1

Full length: 235 amino acids

Entry name: MYCT1_HUMAN

• SKU: ASBPP-326-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-326-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 80177