Recombinant Human MYH7 Protein

Recombinant Human MYH7 Protein
SKU
ASBPP-4197-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P12883

Gene Name: MYH7

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Lys841

End Site: Thr960

Coverage: 0.06

Isoelectric Point: 5

Core Sequence: KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 98%

Alternative gene names: MYHCB

Alternative protein names: Myosin-7; Myosin heavy chain 7; Myosin heavy chain slow isoform; MyHC-slow; Myosin heavy chain; cardiac muscle beta isoform; MyHC-beta

Protein name: myosin heavy chain 7

Full length: 1935 amino acids

Entry name: MYH7_HUMAN
More Information
SKU ASBPP-4197-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4197-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4625
Product information (PDF)
×
MSDS (PDF)
×