Recombinant Human MYL1 Protein

Recombinant Human MYL1 Protein
SKU
ASBPP-4257-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P05976

Gene Name: MYL1

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Met1

End Site: Ile194

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Myosin light chain 1/3; skeletal muscle isoform; MLC1/MLC3; MLC1F/MLC3F; Myosin light chain alkali 1/2; Myosin light chain A1/A2

Protein name: myosin light chain 1

Full length: 194 amino acids

Entry name: MYL1_HUMAN
More Information
SKU ASBPP-4257-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4257-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4632
Product information (PDF)
×
MSDS (PDF)
×