Recombinant Human MYL2 Protein

Recombinant Human MYL2 Protein
SKU
ASBPP-4206-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P10916

Gene Name: MYL2

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Asp166

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: MLC2

Alternative protein names: Myosin regulatory light chain 2; ventricular/cardiac muscle isoform; MLC-2; MLC-2v; Cardiac myosin light chain 2; Myosin light chain 2; slow skeletal/ventricular muscle isoform; MLC-2s/v; Ventricular myosin light chain 2

Protein name: myosin light chain 2

Full length: 166 amino acids

Entry name: MLRV_HUMAN
More Information
SKU ASBPP-4206-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4206-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4633
Product information (PDF)
×
MSDS (PDF)
×