Recombinant Human MYL7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q01449

Gene Name: MYL7

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Glu175

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 62%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: MYL2A; MYLC2A

Alternative protein names: Myosin regulatory light chain 2; atrial isoform; MLC-2a; MLC2a; Myosin light chain 2a; Myosin regulatory light chain 7

Protein name: myosin light chain 7

Full length: 175 amino acids

Entry name: MLRA_HUMAN

• SKU: ASBPP-4058-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4058-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 58498