Recombinant Human MYOG Protein

Recombinant Human MYOG Protein
SKU
ASBPP-4259-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P15173

Gene Name: MYOG

Expression System: Escherichia coli

Molecular Weight: 67.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Asn224

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: BHLHC3; MYF4

Alternative protein names: Myogenin; Class C basic helix-loop-helix protein 3; bHLHc3; Myogenic factor 4; Myf-4

Protein name: myogenin

Full length: 224 amino acids

Entry name: MYOG_HUMAN

Product panel: IHC Pathology,DNA binding & Chromatin
More Information
SKU ASBPP-4259-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4259-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4656
Product information (PDF)
×
MSDS (PDF)
×