Recombinant Human MYOM2 Protein

Recombinant Human MYOM2 Protein
SKU
ASBPP-4204-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P54296

Gene Name: MYOM2

Expression System: Escherichia coli

Molecular Weight: 33.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Pro711

End Site: Glu1000

Coverage: 0.19

Isoelectric Point: 4.5

Core Sequence: PSHPYGITLLNCDGHSMTLGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAVNLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYFVDFREEDAGEWITVNQTTTASRYLKVSDLQQGKTYVFRVRAVNANGVGKPSDTSEPVLVEARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEISDDERFKIETVGDHSKLYLKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 30%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Myomesin-2; 165 kDa connectin-associated protein; 165 kDa titin-associated protein; M-protein; Myomesin family member 2

Protein name: myomesin 2

Full length: 1465 amino acids

Entry name: MYOM2_HUMAN
More Information
SKU ASBPP-4204-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4204-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9172
Product information (PDF)
×
MSDS (PDF)
×