Recombinant Human NACC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96BF6

Gene Name: NACC2

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Thr261

End Site: Gly340

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: TSYHNEEDEEDDEAYDTMVEEQYGQMYIKASGSYAVQEKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 92%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: BTBD14A; NAC2; RBB

Alternative protein names: Nucleus accumbens-associated protein 2; NAC-2; BTB/POZ domain-containing protein 14A; Repressor with BTB domain and BEN domain

Protein name: NACC family member 2

Full length: 587 amino acids

Entry name: NACC2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3349-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3349-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 138151