Recombinant Human NAP1L5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96NT1

Gene Name: NAP1L5

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Glu11

End Site: Ile120

Coverage: 0.66

Isoelectric Point: 5

Core Sequence: EPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 81%, Cynomolgus monkey - 99%

Alternative gene names: DRLM

Alternative protein names: Nucleosome assembly protein 1-like 5; Down-regulated in liver malignancy

Protein name: nucleosome assembly protein 1 like 5

Full length: 182 amino acids

Entry name: NP1L5_HUMAN

• SKU: ASBPP-10475-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10475-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 266812